PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004515128.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 25701.3 Da    PI: 5.671
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004515128.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.71.3e-27959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i+n + rqvtfskRr g++KK eELSvLCda+va+iifsstgkl+eys+
  XP_004515128.1  9 KKIDNATARQVTFSKRRRGLFKKGEELSVLCDADVALIIFSSTGKLFEYSN 59
                    68***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.006161IPR002100Transcription factor, MADS-box
SMARTSM004329.3E-36160IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-25323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.15E-28477IPR002100Transcription factor, MADS-box
CDDcd002654.29E-37577No hitNo description
PfamPF003192.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.44587177IPR002487Transcription factor, K-box
PfamPF014862.4E-1594168IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MASEKIKIKK IDNATARQVT FSKRRRGLFK KGEELSVLCD ADVALIIFSS TGKLFEYSNL  60
SMREILERHH LHSKNLAELE EPSLELQLVE NINCSTLSKE IAEKSHQLRQ MRGEDLHGLN  120
VEELHQLERS LEIGLGRVLE TKEEKIMMEI KHLQRKGMQL MEENDRLMRL EANMNNGKMF  180
GGVESENVVN EEGQSSESVT NVCNSTGPPQ DYVSSDTSLK LGLPYAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-16173173Myocyte-specific enhancer factor 2B
1tqe_Q1e-16173173Myocyte-specific enhancer factor 2B
1tqe_R1e-16173173Myocyte-specific enhancer factor 2B
1tqe_S1e-16173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004515126.11e-165PREDICTED: MADS-box protein SVP-like
RefseqXP_004515127.11e-165PREDICTED: MADS-box protein SVP-like
RefseqXP_004515128.11e-165PREDICTED: MADS-box protein SVP-like
SwissprotQ9FVC11e-108SVP_ARATH; MADS-box protein SVP
TrEMBLG7JXQ91e-136G7JXQ9_MEDTR; MADS-box transcription factor
STRINGGLYMA02G04710.11e-128(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-90MIKC_MADS family protein